4.38 Rating by ClearWebStats
sankalprelocation.com is 4 years 6 months 2 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, sankalprelocation.com is SAFE to browse.
Get Custom Widget

Traffic Report of Sankalprelocation

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
25
Siteadvisor Rating
View sankalprelocation.com site advisor rating Not Applicable

Where is sankalprelocation.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with sankalprelocation.com

Hosted Country:

sankalprelocation.com hosted country US sankalprelocation.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View sankalprelocation.com HTML resources

Homepage Links Analysis

Sankalp Relocation Packers and Movers @ 9352677935, Sankalp Relocation Packers and Movers, packers and movers, Packers And Movers, packers & movers, Sankalp Relocation Packers and Movers, packers, movers, packers & movers, packers and movers services, packers movers, International packers and movers, packers and Movers india, packers and movers Ahmedabad, Sankalp Relocation , Sankalp Relocation Packers, Sankalp Relocation Movers, packers and movers Ahmedabad, packers and movers Ahmedabad, car transporation service, packers and movers company, packers and movers ahmedabad, expert packers and movers, Packers and Movers Services, Door to Door Services, Loading and Unloading Services, Car Transportation Services, Office Relocation Services, Transportation Services, Commercial Shifting Services, Warehouse Services, Insurance Services
Sankalp Relocation Packers and Movers offers packers and movers service, Packers And Movers, Packers & Movers, best Packers And Movers in india, Sankalp Relocation Packers and Movers, packers, movers, packers & movers, packers and movers services, packers movers, international packers and movers, packers and movers india, packers and movers Ahmedabad, Sankalp Relocation , Sankalp Relocation Packers, Sankalp Relocation Movers, packers and movers Ahmedabad, car transporation service, packers and movers company.

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 3
H3 Headings: 4 H4 Headings: 10
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 44
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

sankalprelocation.com favicon - jenniferchemsales.com

View sankalprelocation.com Pagerank   sankalprelocation.com alexa rank Not Applicable   sankalprelocation.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

sankalprelocation.com favicon - shrivishwakarmasafetytraininginstitute.com

View sankalprelocation.com Pagerank   sankalprelocation.com alexa rank Not Applicable   sankalprelocation.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

sankalprelocation.com favicon - theshineenglishacademy.com

View sankalprelocation.com Pagerank   sankalprelocation.com alexa rank Not Applicable   sankalprelocation.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

sankalprelocation.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View sankalprelocation.com Pagerank   sankalprelocation.com alexa rank Not Applicable   sankalprelocation.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

sankalprelocation.com favicon - 247bestpillpharma.com

View sankalprelocation.com Pagerank   sankalprelocation.com alexa rank Not Applicable   sankalprelocation.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 28 Oct 2019 18:11:46 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Sun, 27 Oct 2019 13:10:16 GMT
ETag: "21e008c-6204-595e41aaa3e00-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 6430
Content-Type: text/html

Domain Information for sankalprelocation.com

Domain Registrar: BigRock Solutions Ltd sankalprelocation.com registrar info
Registration Date: 2019-10-26 4 years 6 months 2 weeks ago
Last Modified: 2019-10-26 4 years 6 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net sankalprelocation.com name server information 162.241.148.33 sankalprelocation.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net sankalprelocation.com name server information 162.241.148.33 sankalprelocation.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
sankalprelocation.com A 14399 IP:162.241.148.33
sankalprelocation.com NS 21599 Target:ns2.bh-ht-17.webhostbox.net
sankalprelocation.com NS 21599 Target:ns1.bh-ht-17.webhostbox.net
sankalprelocation.com SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019102605
Refresh:86400
Retry:7200
Expire:3600000
sankalprelocation.com MX 14399 Target:mail.sankalprelocation.com
sankalprelocation.com TXT 14399 TXT:v=spf1 a mx include:webhostbox.net ~all

Similarly Ranked Websites to Sankalprelocation

Google

sankalprelocation.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View sankalprelocation.com Pagerank   Alexa rank for sankalprelocation.com 1   website value of sankalprelocation.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

sankalprelocation.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View sankalprelocation.com Pagerank   Alexa rank for sankalprelocation.com 1   website value of sankalprelocation.com $ 8,833,062,960.00

Gmail

sankalprelocation.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View sankalprelocation.com Pagerank   Alexa rank for sankalprelocation.com 1   website value of sankalprelocation.com $ 8,833,062,960.00

Android Apps on Google Play

sankalprelocation.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View sankalprelocation.com Pagerank   Alexa rank for sankalprelocation.com 1   website value of sankalprelocation.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

sankalprelocation.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View sankalprelocation.com Pagerank   Alexa rank for sankalprelocation.com 1   website value of sankalprelocation.com $ 8,833,062,960.00

Full WHOIS Lookup for sankalprelocation.com

Domain Name: SANKALPRELOCATION.COM
Registry Domain ID: 2447964750_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: http://www.bigrock.com
Updated Date: 2019-10-26T05:34:53Z
Creation Date: 2019-10-26T05:28:43Z
Registry Expiry Date: 2020-10-26T05:28:43Z
Registrar: BigRock Solutions Ltd
Registrar IANA ID: 1495
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-10-28T18:09:21Z